PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00120g14032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 327aa    MW: 36507.8 Da    PI: 8.9343
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00120g14032.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.34.1e-181158148
                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                              k+i  ++ r vtfskRr+g++KKA+EL ++++a+va ++fs+tgk y+
  Peinf101Scf00120g14032.1 11 KKITKDTSRMVTFSKRRQGLFKKASELETMTGARVATVVFSPTGKPYT 58
                              678999**************************************9876 PP

2SRF-TF56.34.1e-18184231148
                               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
                    SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 
                               k+i  ++ r vtfskRr+g++KKA+EL ++++a+va ++fs+tgk y+
  Peinf101Scf00120g14032.1 184 KKITKDTSRMVTFSKRRQGLFKKASELETMTGARVATVVFSPTGKPYT 231
                               678999**************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.194363IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-24362IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-20463IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-14525IPR002100Transcription factor, MADS-box
PfamPF003197.4E-231258IPR002100Transcription factor, MADS-box
CDDcd001202.64E-181860No hitNo description
PRINTSPR004041.5E-142540IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-144061IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.194176236IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-24176235IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-20177236IPR002100Transcription factor, MADS-box
PfamPF003197.4E-23185231IPR002100Transcription factor, MADS-box
CDDcd001202.64E-18191233No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGTGKKKIDI KKITKDTSRM VTFSKRRQGL FKKASELETM TGARVATVVF SPTGKPYTSG  60
NVSYAIERHF CGSTDQPSSS HHSSSIDDVS GGSSTSNSAS RNGLYDWLED IDVEECQNLN  120
ELLLLKEQLE GTRKKLASIE DSESFQALFM LLESLLQFIC LWEQLLFPIL HLKMGTGKKK  180
IDIKKITKDT SRMVTFSKRR QGLFKKASEL ETMTGARVAT VVFSPTGKPY TSGNVSYAIE  240
RHFCGSTDQP SSSHHSSSID DISGGIILLL LMMFLVAPRR RIRPRGMDID VEECQNLNEL  300
LLLKEQLEGT RKKLASIEDS ESFQALF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016581849.11e-61PREDICTED: agamous-like MADS-box protein AGL23
TrEMBLK4B0J42e-52K4B0J4_SOLLC; Uncharacterized protein
STRINGSolyc01g098070.1.16e-52(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23371757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.11e-12AGAMOUS-like 29